Search Ontology:
ChEBI
kisspeptin-54
- Term ID
- CHEBI:80304
- Synonyms
-
- Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2
- GYSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKALPAYNWNSFGLRF-NH2
- Kisspeptin
- Metastin
- Definition
- A 65-membered peptide hormone consisting of Gly, Thr, Ser, Leu, Ser, Pro, Pro, Pro, Glu, Ser, Ser, Gly, Ser, Arg, Gln, Gln, Pro, Gly, Leu, Ser, Ala, Pro, His, Ser, Arg, Gln, Ile, Pro, Ala, Pro, Gln, Gly, Ala, Val, Leu, Val, Gln, Arg, Glu, Lys, Asp, Leu, Pro, Asn, Tyr, Asn, Trp, Asn, Ser, Phe, Gly, Leu, Arg and Phe-NH2 residues joined in sequence.
- References
-
- KEGG:C16090
- PMID:25036713
- PMID:25995272
- PMID:26089302
- PMID:26192876
- PMID:26572695
- PMID:26973595
- PMID:27065948
- PMID:27246282
- PMID:27379743
- PMID:27589480
- PMID:27616469
- PMID:27990162
- PMID:28112678
- PMID:28393578
- PMID:28458903
- PMID:28490208
- PMID:28636637
- PMID:28746808
- PMID:28754347
- Reaxys:24324304
- Wikipedia:Kisspeptin
- Ontology
- ChEBI ( EBI )
- is a type of
-
- has_role
-
Show first 5 Terms
Phenotype
Phenotype resulting from kisspeptin-54
Phenotype where environments contain kisspeptin-54
Phenotype modified by environments containing kisspeptin-54
Phenotype affecting kisspeptin-54
Human Disease Model