Search Ontology:
ChEBI
kisspeptin-54
- Term ID
- CHEBI:80304
- Synonyms
-
- Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2
- GYSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKALPAYNWNSFGLRF-NH2
- Kisspeptin
- Metastin
- Definition
- A 65-membered peptide hormone consisting of Gly, Thr, Ser, Leu, Ser, Pro, Pro, Pro, Glu, Ser, Ser, Gly, Ser, Arg, Gln, Gln, Pro, Gly, Leu, Ser, Ala, Pro, His, Ser, Arg, Gln, Ile, Pro, Ala, Pro, Gln, Gly, Ala, Val, Leu, Val, Gln, Arg, Glu, Lys, Asp, Leu, Pro, Asn, Tyr, Asn, Trp, Asn, Ser, Phe, Gly, Leu, Arg and Phe-NH2 residues joined in sequence.
- References
-
- KEGG:C16090
- PMID:25036713
- PMID:25995272
- PMID:26089302
- PMID:26192876
- PMID:26572695
- PMID:26973595
- PMID:27065948
- PMID:27246282
- PMID:27379743
- PMID:27589480
- PMID:27616469
- PMID:27990162
- PMID:28112678
- PMID:28393578
- PMID:28458903
- PMID:28490208
- PMID:28636637
- PMID:28746808
- PMID:28754347
- Reaxys:24324304
- Wikipedia:Kisspeptin
- Ontology
- ChEBI ( EBI )
- is a type of
-
- has_role
-
Phenotype
Phenotype resulting from kisspeptin-54
Phenotype where environments contain kisspeptin-54
Phenotype modified by environments containing kisspeptin-54
Human Disease Model