Search Ontology:
ChEBI
gastrin-34
- Term ID
- CHEBI:75437
- Synonyms
-
- Big gastrin
- Gln-Leu-Gly-Pro-Gln-Gly-Pro-Pro-His-Leu-Val-Ala-Asp-Pro-Ser-Lys-Lys-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe
- L-glutaminyl-L-leucylglycyl-L-prolyl-L-glutaminylglycyl-L-prolyl-L-prolyl-L-histidyl-L-leucyl-L-valyl-L-alanyl-L-alpha-aspartyl-L-prolyl-L-seryl-L-lysyl-L-lysyl-L-glutaminylglycyl-L-prolyl-L-tryptophyl-L-leucyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-gl
- QLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMAF
- Definition
- One of the primary forms of gastrin that is a 34-membered peptide consisting of Gln, Leu, Gly, Pro, Gln, Gly, Pro, Pro, His, Leu, Val, Ala, Asp, Pro, Ser, Lys, Lys, Gln, Gly, Pro, Trp, Leu, Glu, Glu, Glu, Glu, Glu, Ala, Tyr, Gly, Trp, Met, Asp and Phe residues joined in sequence.
- References
-
- CAS:53988-98-0
- KEGG:C18187
- PMID:143815
- PMID:20493085
- PMID:22001226
- PMID:3061841
- PMID:4116961
- PMID:463490
- PMID:6783501
- PMID:7053336
- PMID:8278633
- Patent:AU2008303957
- Patent:EP2185180
- Patent:KR20100056511
- Patent:US2010190711
- Patent:WO2008106775
- Reaxys:18478868
- Wikipedia:Gastrin-34
- Ontology
- ChEBI ( EBI )
- is a type of
-
Phenotype
Phenotype resulting from gastrin-34
Phenotype where environments contain gastrin-34
Phenotype modified by environments containing gastrin-34
Phenotype affecting gastrin-34
Human Disease Model